LMAN1 Rabbit Polyclonal Antibody (HRP)
LMAN1 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53
UniProt
P49257
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LMAN1
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS
Field of Research
Cell Biology
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
54kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_005561
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
303139 100 µg
ATP2A2, NT (AT2A2_HUMAN, ATP2B, ATPase Ca++ Transporting Cardiac Muscle Slow Twitch 2, Calcium Pump 2, Calcium-transporting ATPase Sarcoplasmic Reticulum Type, Calcium-transporting ATPase Sarcoplasmic Reticulum Type Slow Twitch Skeletal Muscle Isoform, Cardiac Ca2+ ATPase, DAR, DD, Endoplasmic Reticulum Class 1/2 Ca (2+) ATPase, Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 2, SERCA 2, SERCA2, Serca2a, Slow Twitch Skeletal Muscle Isoform, SR Ca (2+) -ATPase 2)
Sign In for Pricing
View Details 
043155-APC 200 µL
TPD52L1, NT (TPD52L1, Tumor protein D53, Tumor protein D52-like 1) (APC) discontinued
Sign In for Pricing
View Details GTR15369632 1 Vial
Lentiviral human ATF3 sgRNA gene knockout kit - Lentiviral human ATF3 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details MBS6454931-01 0.1 mL
CD300d (CMRF35-like Molecule 4, CLM-4, CD300 antigen-like Family Member D, CMRF35-A4, CD300d, CD300LD, CD300D, CMRF35A4) (APC)
Sign In for Pricing
View Details MBS6454931-02 5x 0.1 mL
CD300d (CMRF35-like Molecule 4, CLM-4, CD300 antigen-like Family Member D, CMRF35-A4, CD300d, CD300LD, CD300D, CMRF35A4) (APC)
Sign In for Pricing
View Details