Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1 Rabbit Polyclonal Antibody (Biotin)

LMAN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53

UniProt

P49257

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LMAN1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL
BNC680843-500 1x 500 µL

CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LEO1 Lentiviral Activation Particles (m)
sc-433465-LAC 200 µL

LEO1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rat Tmprss7 Pre-designed siRNA Set A
SI214914A 1 Each

Rat Tmprss7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Electric lift patient transfer Wheelchair BHBD-1105
BHBD-1105 1 Unit

Electric lift patient transfer Wheelchair BHBD-1105

Sign In for Pricing
View Details
Mmu-miR-203-5p miRNA Agomir
CMN0394-01 5 nmol

Mmu-miR-203-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-203-5p miRNA Agomir
CMN0394-02 10 nmol

Mmu-miR-203-5p miRNA Agomir

Sign In for Pricing
View Details