Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN1, Human (His)

The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

BIN1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bin1-protein-human-his.html

Purity

96.00

Smiles

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Molecular Formula

274 (Gene_ID) O00499-10 (M1-P424) (Accession)

Molecular Weight

Approximately 54 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC5 Recombinant Rabbit monoclonal Antibody
HA751235 100 µL

HDAC5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CDw17 (H018.3G-6.F5), 0.2mg/mL
BNUB1092-500 1x 500 µL

CDw17 (H018.3G-6.F5), 0.2mg/mL

Sign In for Pricing
View Details
CD247 (NM_198053) Human Over-expression Lysate
LY403667 100 µg

CD247 (NM_198053) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Bromo-2-chlorobenzoic Acid
TRC-B682120-25G 25 g

5-Bromo-2-chlorobenzoic Acid

Sign In for Pricing
View Details
BTC Antibody
KC-7558-01 50 μL

BTC Antibody

Sign In for Pricing
View Details
BTC Antibody
KC-7558-02 100 µL

BTC Antibody

Sign In for Pricing
View Details