Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN1, Human (His)

The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

BIN1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bin1-protein-human-his.html

Purity

96.00

Smiles

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Molecular Formula

274 (Gene_ID) O00499-10 (M1-P424) (Accession)

Molecular Weight

Approximately 54 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NEGR1 siRNA
abx903525-01 15 nmol

Human NEGR1 siRNA

Sign In for Pricing
View Details
Human NEGR1 siRNA
abx903525-02 30 nmol

Human NEGR1 siRNA

Sign In for Pricing
View Details
Density Std 0.7407g/mL at 80C - 100ML
DEN80080 100 mL

Density Std 0.7407g/mL at 80C - 100ML

Sign In for Pricing
View Details
CA5A Rabbit Polyclonal Antibody (Biotin)
orb2097784 100 µL

CA5A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PUF60 Antibody
MBS9416143-01 0.1 mL

PUF60 Antibody

Sign In for Pricing
View Details
PUF60 Antibody
MBS9416143-02 5x 0.1 mL

PUF60 Antibody

Sign In for Pricing
View Details