Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UST Rabbit Polyclonal Antibody (HRP)

UST Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2OST

UniProt

Q9Y2C2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UST

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Trontinemab
HY235086-01 100 µg

Research Grade Trontinemab

Sign In for Pricing
View Details
Research Grade Trontinemab
HY235086-02 1 mg

Research Grade Trontinemab

Sign In for Pricing
View Details
Anti-CUL2 Antibody Picoband®, Dylight550 Conjugate
A02986-3-Dylight550 100 µg

Anti-CUL2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
SDCBP (Syndecan-binding protein 1, Syntenin-1, Melanoma differentiation-associated protein 9, ST1, SYCL, MDA-9, TACIP18) discontinued
213273-01 20 µL

SDCBP (Syndecan-binding protein 1, Syntenin-1, Melanoma differentiation-associated protein 9, ST1, SYCL, MDA-9, TACIP18) discontinued

Sign In for Pricing
View Details
SDCBP (Syndecan-binding protein 1, Syntenin-1, Melanoma differentiation-associated protein 9, ST1, SYCL, MDA-9, TACIP18) discontinued
213273-02 100 µL

SDCBP (Syndecan-binding protein 1, Syntenin-1, Melanoma differentiation-associated protein 9, ST1, SYCL, MDA-9, TACIP18) discontinued

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody [Clone ID: LBI2E7]
AMM17541VCF 100 µg

MMP3 Mouse Monoclonal Antibody [Clone ID: LBI2E7]

Sign In for Pricing
View Details