Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP16 Rabbit Polyclonal Antibody (FITC)

MMP16 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MMP-X2, C8orf57, MT-MMP2, MT-MMP3, MT3-MMP

UniProt

P51512

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MMP16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005932

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING Finger Protein 20 (RNF20, E3 Ubiquitin-protein Ligase BRE1A, BRE1A, BRE1-A, BRE1, hBRE1) (AP) discontinued
132685-AP 100 µL

RING Finger Protein 20 (RNF20, E3 Ubiquitin-protein Ligase BRE1A, BRE1A, BRE1-A, BRE1, hBRE1) (AP) discontinued

Sign In for Pricing
View Details
CREB (cAMP Response Element Binding Protein) (MaxLight 750) discontinued
C7915-27-ML750 100 µL

CREB (cAMP Response Element Binding Protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Methyl dodonate A acetate
orb1682120 5 mg

Methyl dodonate A acetate

Sign In for Pricing
View Details
([13C6]Leu17)-Thymosin b4 (human, bovine, horse, rat)
H-7244.1000 1.0mg

([13C6]Leu17)-Thymosin b4 (human, bovine, horse, rat)

Sign In for Pricing
View Details
Rat Hsd17b7 Pre-designed siRNA Set B
SI206441B 1 Each

Rat Hsd17b7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human YBX1 Protein
orb429266-01 5 µg

Human YBX1 Protein

Sign In for Pricing
View Details