Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Man2a2 Rabbit Polyclonal Antibody (FITC)

Man2a2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MX, Man IIx, AI480988, 1700052O22Rik, 4931438M07Rik

UniProt

Q8BRK9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766491

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTK3 antibody
70R-10471 100 µL

PCTK3 antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)
TRV-0059316-01 20 µL

Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)

Sign In for Pricing
View Details
Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)
TRV-0059316-02 100 µL

Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)

Sign In for Pricing
View Details
Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)
TRV-0059316-03 200 µL

Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)

Sign In for Pricing
View Details
Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)
TRV-0059316-04 1 mL

Monoclonal Antibody to Inhibitory Subunit Of NF Kappa B Alpha (IkBa)

Sign In for Pricing
View Details
Toxic Shock Syndrome Toxin (TSST) (MaxLight 750) discontinued
T8069-95D-ML750 100 µL

Toxic Shock Syndrome Toxin (TSST) (MaxLight 750) discontinued

Sign In for Pricing
View Details