Anionic trypsin-2, Rat (P.pastoris, His)
Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
Anionic trypsin-2 Protein, Rat (P.pastoris, His), Rat, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/anionic-trypsin-2-protein-rat-p-pastoris-his.html
Smiles
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Molecular Formula
25052 (Gene_ID) P00763 (I24-N246) (Accession)
Molecular Weight
Approximately 25.3 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400608 100 µg
alpha smooth muscle Actin (ACTA2) (NM_001613) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSM041090-02 100 µg
Recombinant Mouse Interleukin-33/IL-33 Protein
Sign In for Pricing
View Details 
AN302109L-01 50 µL
Recombinant Histone H3 (Di Methyl Lys56) Monoclonal Antibody
Sign In for Pricing
View Details