Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anionic trypsin-2, Rat (P.pastoris, His)

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Anionic trypsin-2 Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/anionic-trypsin-2-protein-rat-p-pastoris-his.html

Smiles

IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

Molecular Formula

25052 (Gene_ID) P00763 (I24-N246) (Accession)

Molecular Weight

Approximately 25.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAT Rabbit Monoclonal Antibody
TA422894 100 µL

PLAT Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
5-Azido-5-deoxy-D-fructose
TRC-A824200-5MG 5 mg

5-Azido-5-deoxy-D-fructose

Sign In for Pricing
View Details
PerCP Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116F-01 50 Tests

PerCP Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116F-02 100 Tests

PerCP Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116F-03 2x 100 Tests

PerCP Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
Fast Blue B Salt
TRC-F150003-5G 5 g

Fast Blue B Salt

Sign In for Pricing
View Details