Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT6 Rabbit Polyclonal Antibody (FITC)

WNT6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9Y6F9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006513

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP3 (MAGUK p55 Subfamily Member 3, Discs Large Homolog 3, DLG3, Protein MPP3)
129818 100 µg

MPP3 (MAGUK p55 Subfamily Member 3, Discs Large Homolog 3, DLG3, Protein MPP3)

Sign In for Pricing
View Details
IGFBP-4 (Insulin Like Growth Factor Binding Protein 4) Rabbit ELISA Kit
E1868 96 Tests

IGFBP-4 (Insulin Like Growth Factor Binding Protein 4) Rabbit ELISA Kit

Sign In for Pricing
View Details
Double-Strand Break Repair Protein MRE11 (MRE11) Antibody
abx001996-01 60 µL

Double-Strand Break Repair Protein MRE11 (MRE11) Antibody

Sign In for Pricing
View Details
Double-Strand Break Repair Protein MRE11 (MRE11) Antibody
abx001996-02 120 µL

Double-Strand Break Repair Protein MRE11 (MRE11) Antibody

Sign In for Pricing
View Details
Double-Strand Break Repair Protein MRE11 (MRE11) Antibody
abx001996-03 200 µL

Double-Strand Break Repair Protein MRE11 (MRE11) Antibody

Sign In for Pricing
View Details
ZMAT2 Antibody, FITC conjugated
A45351-50UG 50 µg

ZMAT2 Antibody, FITC conjugated

Sign In for Pricing
View Details