Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt6 Rabbit Polyclonal Antibody (FITC)

Wnt6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

D4A3W9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RAT Wnt6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101696

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human
051544-01 10 µg

Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human
051544-02 50 µg

Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human
051544-03 100 µg

Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human
051544-04 200 µg

Tumor Necrosis Factor Receptor Superfamily, Member 8 (TNFRSF8), Recombinant, Human

Sign In for Pricing
View Details
rno-miR-25-5p miRNA Inhibitor
MIR01356 2x 5.0 nmol

rno-miR-25-5p miRNA Inhibitor

Sign In for Pricing
View Details
STAU2 Rabbit Polyclonal Antibody (BF488)
orb2548321 100 µL

STAU2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details