Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt6 Rabbit Polyclonal Antibody (HRP)

Wnt6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D4A3W9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RAT Wnt6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101696

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), 0.2mg/mL
BNUB1801-100 1x 100 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), 0.2mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), Biotin conjugate, 0.1mg/mL
BNCB2398-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2398), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®660R Rabbit Anti-RFP
20478 100 µL

CF®660R Rabbit Anti-RFP

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL
BNC401526-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/2479), 1mg/mL
BNUM3790-50 1x 50 µL

CD3e (T-Cell Marker) (rC3e/2479), 1mg/mL

Sign In for Pricing
View Details
GC Polyclonal Antibody
E-AB-10680-01 20 µL

GC Polyclonal Antibody

Sign In for Pricing
View Details