Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corin Rabbit Polyclonal Antibody (FITC)

Corin Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, Lrp4, AV273130

UniProt

Q9Z319

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Corin

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGNKMPFKLQEGEVRIIPLEQCQSYFDMKTITNRMICAGYESGTVDSCMG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit
MBS2803636-01 48 Tests

Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit

Sign In for Pricing
View Details
Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit
MBS2803636-02 96 Tests

Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit

Sign In for Pricing
View Details
Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit
MBS2803636-03 5x 96 Tests

Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit

Sign In for Pricing
View Details
Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit
MBS2803636-04 10x 96 Tests

Human Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) ELISA Kit

Sign In for Pricing
View Details
mmu-miR-8119 miRNA Inhibitor
MIM03216 2x 5.0 nmol

mmu-miR-8119 miRNA Inhibitor

Sign In for Pricing
View Details
Nemorexant (Daridorexant) Impurity 5
RM-N164005-01 10 mg

Nemorexant (Daridorexant) Impurity 5

Sign In for Pricing
View Details