Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGRMC1 Rabbit Polyclonal Antibody (HRP)

PGRMC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IZA, MPR, Dap1, HPR6.6

UniProt

O00264

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PGRMC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006658

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear pore membrane glycoprotein 210 (HRP)
326422-01 50 µg

Nuclear pore membrane glycoprotein 210 (HRP)

Sign In for Pricing
View Details
Nuclear pore membrane glycoprotein 210 (HRP)
326422-02 100 µg

Nuclear pore membrane glycoprotein 210 (HRP)

Sign In for Pricing
View Details
Anti Oleiagrimonas Cullin4 Like Pab
272576 100 µg

Anti Oleiagrimonas Cullin4 Like Pab

Sign In for Pricing
View Details
Lentiviral mouse Uroc1 shRNA (UAS) - Lentiviral mouse Uroc1 shRNA (UAS, iRFP) plasmid
GTR15270364 1 Vial

Lentiviral mouse Uroc1 shRNA (UAS) - Lentiviral mouse Uroc1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Phospho-FLT3 (Tyr969) Colorimetric Cell-Based ELISA Kit
MBS9501625-01 1 Kit

Phospho-FLT3 (Tyr969) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-FLT3 (Tyr969) Colorimetric Cell-Based ELISA Kit
MBS9501625-02 5x 1 Kit

Phospho-FLT3 (Tyr969) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details