SARS-CoV-2 S glycoprotein (V367F, HEK293, His)
SARS-CoV-2 S glycoprotein (V367F, HEK 293, His) is a SARS-CoV-2 S glycoprotein V367F protein with a His-flag. SARS-CoV-2 S glycoprotein (V367F) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change V367F. The mutant type V367F continuously circulating worldwide displays higher binding affinity to human ACE2 [1].
Product Specifications
Product Name Alternative
SARS-CoV-2 S glycoprotein (V367F, HEK293, His), Virus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sars-cov-2-s-glycoprotein-v367f-hek-293-his.html
Smiles
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Molecular Formula
43740568 (Gene_ID) P0DTC2 (R319-F541, V367F) (Accession)
Molecular Weight
Approximately 27.9 kDa
References & Citations
[1]Junxian Ou, et al. V367F Mutation in SARS-CoV-2 Spike RBD Emerging during the Early Transmission Phase Enhances Viral Infectivity through Increased Human ACE2 Receptor Binding Affinity. J Virol. 2021 Jul 26;95 (16) :e0061721.|[2]Leonid Yurkovetskiy, et al. Structural and Functional Analysis of the D614G SARS-CoV-2 Spike Protein Variant. Cell. 2020 Oct 29;183 (3) :739-751.e8.|[3]Jessica A Plante, et al. Spike mutation D614G alters SARS-CoV-2 fitness. Nature. 2021 Apr;592 (7852) :116-121.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040204-100 1x 100 µL
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682488-100 1x 100 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details