Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAN1A2 Rabbit Polyclonal Antibody (HRP)

MAN1A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAN1B

UniProt

O60476

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAN1A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEPD1 Rabbit Polyclonal Antibody
orb1880098-01 30 µL

EEPD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEPD1 Rabbit Polyclonal Antibody
orb1880098-02 50 µL

EEPD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEPD1 Rabbit Polyclonal Antibody
orb1880098-03 100 µL

EEPD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEPD1 Rabbit Polyclonal Antibody
orb1880098-04 200 µL

EEPD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) APC
MBS6398536-01 0.1 mL

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) APC

Sign In for Pricing
View Details
WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) APC
MBS6398536-02 5x 0.1 mL

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) APC

Sign In for Pricing
View Details