Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN2 Rabbit Polyclonal Antibody (Biotin)

LMAN2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GP36B, VIP36, C5orf8

UniProt

Q12907

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LMAN2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006807

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOL2B, NT (MOB3B, MOBKL2B, MOB kinase activator 3B, Mob1 homolog 2b, Mps one binder kinase activator-like 2B)
MBS6008170-01 0.2 mL

MOL2B, NT (MOB3B, MOBKL2B, MOB kinase activator 3B, Mob1 homolog 2b, Mps one binder kinase activator-like 2B)

Sign In for Pricing
View Details
MOL2B, NT (MOB3B, MOBKL2B, MOB kinase activator 3B, Mob1 homolog 2b, Mps one binder kinase activator-like 2B)
MBS6008170-02 5x 0.2 mL

MOL2B, NT (MOB3B, MOBKL2B, MOB kinase activator 3B, Mob1 homolog 2b, Mps one binder kinase activator-like 2B)

Sign In for Pricing
View Details
Lentiviral mouse 4930404N11Rik shRNA (UAS) - Lentiviral mouse 4930404N11Rik shRNA (UAS) (25)
GTR15232385 1 Vial

Lentiviral mouse 4930404N11Rik shRNA (UAS) - Lentiviral mouse 4930404N11Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
TP73-AS1 Polyclonal Antibody
MBS9236157-01 0.1 mL

TP73-AS1 Polyclonal Antibody

Sign In for Pricing
View Details
TP73-AS1 Polyclonal Antibody
MBS9236157-02 5x 0.1 mL

TP73-AS1 Polyclonal Antibody

Sign In for Pricing
View Details
BEAN1 Human Gene Knockout Kit (CRISPR)
KN427848 1 Kit

BEAN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details