Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN2 Rabbit Polyclonal Antibody (HRP)

LMAN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GP36B, VIP36, C5orf8

UniProt

Q12907

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LMAN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006807

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TPI1 Protein, N-His
E55P4378 50 µg

Recombinant Human TPI1 Protein, N-His

Sign In for Pricing
View Details
FXYD6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0824407 1.0 µg DNA

FXYD6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Large Glass Plate Rack
CSL-LGR 1 Each

Large Glass Plate Rack

Sign In for Pricing
View Details
HTR3D Knockout Cell Lysate
ABC-KC0883 100 µg

HTR3D Knockout Cell Lysate

Sign In for Pricing
View Details
Lentiviral mouse Tab3 shRNA (UAS) - Lentiviral mouse Tab3 shRNA (UAS, iRFP) (25)
GTR15232670 1 Vial

Lentiviral mouse Tab3 shRNA (UAS) - Lentiviral mouse Tab3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ALDH6A1 Mouse mAb Antibody
orb3016298 100 µL

ALDH6A1 Mouse mAb Antibody

Sign In for Pricing
View Details