Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED1 Rabbit Polyclonal Antibody (Biotin)

TMED1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tp24, p24g1, Il1rl1l, IL1RL1LG

UniProt

Q13445

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMED1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Latent-transforming Growth Factor β-binding protein 2 (LTBP2) Rat ELISA Kit
E6037 96 Tests

Latent-transforming Growth Factor β-binding protein 2 (LTBP2) Rat ELISA Kit

Sign In for Pricing
View Details
CELLSTAR® Petri dish, TC, 100x20mm, 58cm2, polystyrene, with vents, subpacked per 15 pieces, triple packed, STERILE, SAL 10−6, 180 pieces per CAR
664160-TRI 180 pieces per CAR

CELLSTAR® Petri dish, TC, 100x20mm, 58cm2, polystyrene, with vents, subpacked per 15 pieces, triple packed, STERILE, SAL 10−6, 180 pieces per CAR

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit
MBS160481-01 48 Well

Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit
MBS160481-02 96 Well

Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit
MBS160481-03 5x 96 Well

Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit
MBS160481-04 10x 96 Well

Mouse matrix metalloproteinase 13, MMP-13 ELISA Kit

Sign In for Pricing
View Details