Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmed1 Rabbit Polyclonal Antibody (Biotin)

Tmed1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Il1rl1l

UniProt

Q5BK85

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001013450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0047654-01 24 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0047654-02 48 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0047654-03 96 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0047654-04 5x 96 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0047654-05 10x 96 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
TRIM23, NT (TRIM23, ARD1, ARFD1, RNF46, E3 ubiquitin-protein ligase TRIM23, ADP-ribosylation factor domain-containing protein 1, GTP-binding protein ARD-1, RING finger protein 46, Tripartite motif-containing protein 23) (MaxLight 490) discontinued
043219-ML490 100 µL

TRIM23, NT (TRIM23, ARD1, ARFD1, RNF46, E3 ubiquitin-protein ligase TRIM23, ADP-ribosylation factor domain-containing protein 1, GTP-binding protein ARD-1, RING finger protein 46, Tripartite motif-containing protein 23) (MaxLight 490) discontinued

Sign In for Pricing
View Details