Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmed1 Rabbit Polyclonal Antibody (HRP)

Tmed1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Il1rl1l

UniProt

Q5BK85

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001013450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NUMBL (NM_004756) AAV Particle
RC216869A1V 250 µL

Human NUMBL (NM_004756) AAV Particle

Sign In for Pricing
View Details
KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (PE)
MBS6312356-01 0.2 mL

KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (PE)

Sign In for Pricing
View Details
KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (PE)
MBS6312356-02 5x 0.2 mL

KCND1, NT (KCND1, Potassium voltage-gated channel subfamily D member 1, Voltage-gated potassium channel subunit Kv4.1) (PE)

Sign In for Pricing
View Details
Vgll3 (NM_028572) Mouse Tagged ORF Clone
MG217588 10 µg

Vgll3 (NM_028572) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD19, Recombinant, Human, aa21-291, Fc-Tag, Avi-Tag
544205 100 µg

CD19, Recombinant, Human, aa21-291, Fc-Tag, Avi-Tag

Sign In for Pricing
View Details
Human Autocrine Motility Factor Receptor (AMFR) ELISA Kit
abx250989-01 96 Tests

Human Autocrine Motility Factor Receptor (AMFR) ELISA Kit

Sign In for Pricing
View Details