Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GAT1 Rabbit Polyclonal Antibody (Biotin)

B4GAT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IGAT, iGNT, B3gnt1, B3gnt6, BETA3GNT1, 1500032M01Rik

UniProt

Q8BWP8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse B3gnt1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_780592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit
MBS9320155-01 48 Well

Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit

Sign In for Pricing
View Details
Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit
MBS9320155-02 96 Well

Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit

Sign In for Pricing
View Details
Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit
MBS9320155-03 5x 96 Well

Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit

Sign In for Pricing
View Details
Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit
MBS9320155-04 10x 96 Well

Rat Poly [ADP-ribose] polymerase 1, PARP1 ELISA Kit

Sign In for Pricing
View Details
TBC1D16 Rabbit Polyclonal Antibody (Cy5)
orb968008 100 µL

TBC1D16 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Phospho-HSF1 (Ser303 + Ser307) Rabbit Polyclonal Antibody (BF647)
orb2498857 100 µL

Phospho-HSF1 (Ser303 + Ser307) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details