Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTN4 Rabbit Polyclonal Antibody (FITC)

RTN4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASY, NSP, NOGO, RTN-X, NSP-CL, RTN4-A, RTN4-C, RTN4-B1, RTN4-B2, NI220/250, Nbla00271, Nbla10545

UniProt

Q7L7Q5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RTN4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_008939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF1 Knockout Hep 3B2.1-7 Cell Line
ARG43876 1 Million

GDF1 Knockout Hep 3B2.1-7 Cell Line

Sign In for Pricing
View Details
P53 (AcK319) peptide
orb304883-01 1 mg

P53 (AcK319) peptide

Sign In for Pricing
View Details
P53 (AcK319) peptide
orb304883-02 5 mg

P53 (AcK319) peptide

Sign In for Pricing
View Details
E130311K13Rik Mouse shRNA Plasmid (Locus ID 329659)
TL514373 1 Kit

E130311K13Rik Mouse shRNA Plasmid (Locus ID 329659)

Sign In for Pricing
View Details
TRPM2 CRISPRa sgRNA lentivector (set of three targets)(Human)
48521121 3x 1.0µg DNA

TRPM2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
BSA Conjugated Human Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
RPU50810-01 50 µg

BSA Conjugated Human Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details