Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM115 Rabbit Polyclonal Antibody (HRP)

TMEM115 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PL6

UniProt

Q12893

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM115

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008955

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICEF1, CT (IPCEF1, KIAA0403, Interactor protein for cytohesin exchange factors 1, Phosphoinositide-binding protein PIP3-E)
MBS6001238-01 0.2 mL

ICEF1, CT (IPCEF1, KIAA0403, Interactor protein for cytohesin exchange factors 1, Phosphoinositide-binding protein PIP3-E)

Sign In for Pricing
View Details
ICEF1, CT (IPCEF1, KIAA0403, Interactor protein for cytohesin exchange factors 1, Phosphoinositide-binding protein PIP3-E)
MBS6001238-02 5x 0.2 mL

ICEF1, CT (IPCEF1, KIAA0403, Interactor protein for cytohesin exchange factors 1, Phosphoinositide-binding protein PIP3-E)

Sign In for Pricing
View Details
StemLight™ Pluripotency Antibody Kit
CST 9656S 1 Kit

StemLight™ Pluripotency Antibody Kit

Sign In for Pricing
View Details
Olfactory receptor 10K1/2 Polyclonal Antibody
RA28047-01 50 µL

Olfactory receptor 10K1/2 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 10K1/2 Polyclonal Antibody
RA28047-02 100 µL

Olfactory receptor 10K1/2 Polyclonal Antibody

Sign In for Pricing
View Details
NCR1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-41214R-APC-Cy7 100 µL

NCR1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details