Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FICD Rabbit Polyclonal Antibody (FITC)

FICD Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HYPE, HIP13, UNQ3041

UniProt

Q9BVA6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FICD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_009007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133A-01 25 µg

Purified Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
Purified Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133A-02 100 µg

Purified Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
REV1 Human Gene Knockout Kit (CRISPR)
KN217528RB 1 Kit

REV1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RING finger protein unkempt like (UNKL) (NM_001193388) Human Over-expression Lysate
LC434369 20 µg

RING finger protein unkempt like (UNKL) (NM_001193388) Human Over-expression Lysate

Sign In for Pricing
View Details
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Over-expression Lysate
LY401028 100 µg

Ribonuclease Inhibitor (RNH1) (NM_002939) Human Over-expression Lysate

Sign In for Pricing
View Details
TACD2 (TACSTD2) (NM_002353) Human Over-expression Lysate
LY419381 100 µg

TACD2 (TACSTD2) (NM_002353) Human Over-expression Lysate

Sign In for Pricing
View Details