Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A4 Rabbit Polyclonal Antibody (HRP)

UGT1A4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GNT1, UGT1, UDPGT, UGT1A, UGT1D, UGT-1A, UGT-1D, UGT1.1, UGT1.4, UGT1A1, HUG-BR2, UGT1-01, UGT1-04, UGT1A4S, hUG-BR1, UDPGT 1-4

UniProt

P22310

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_009051

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm14851 sgRNA CRISPR Lentivector set (Mouse)
K3062401 3x 1.0 µg

Gm14851 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis Mb0915c Protein (aa 1-285)
VAng-Yyj3383-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Bovis Mb0915c Protein (aa 1-285)

Sign In for Pricing
View Details
ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (HRP)
MBS6443759-01 0.1 mL

ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (HRP)

Sign In for Pricing
View Details
ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (HRP)
MBS6443759-02 5x 0.1 mL

ZDHHC17 (Zinc Finger CCHC Domain Containing 17, HIP3, HYPH, HIP14, HSPC294) (HRP)

Sign In for Pricing
View Details
FBXO38 Polyclonal Conjugated Antibody
MBS9439268-01 0.1 mL (Biotin)

FBXO38 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
FBXO38 Polyclonal Conjugated Antibody
MBS9439268-02 0.1 mL (AF350)

FBXO38 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details