S100A15A, Mouse
The S100A15A protein is part of the Tyr protein kinase family in the ROR subfamily and is related to phosphorylation events, especially phosphorylation events on tyrosine residues. Its association with the receptor tyrosine kinase-like orphan receptor (ROR) family suggests its potential role in cell signaling pathways, affecting processes such as cell growth and differentiation. S100A15A Protein, Mouse is the recombinant mouse-derived S100A15A protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
S100A15A Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a15a-protein-mouse.html
Purity
95.18
Smiles
MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
Molecular Formula
381493 (Gene_ID) Q6S5I3 (M1-Y108) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Transferrin Receptor 2 (TFR2), Recombinant, Mouse, His-Tag
Transferrin Receptor 2 (TFR2), Recombinant, Mouse, His-Tag
Transferrin Receptor 2 (TFR2), Recombinant, Mouse, His-Tag
Transferrin Receptor 2 (TFR2), Recombinant, Mouse, His-Tag