Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC63 Rabbit Polyclonal Antibody (HRP)

SEC63 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERdj2, PCLD2, SEC63L, DNAJC23, PRO2507

UniProt

Q9UGP8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SEC63

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dhh 3'UTR GFP Stable Cell Line
TU155113 1.0 mL

Dhh 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HERPUD1 (HERP, KIAA0025, MIF1, Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein, Methyl Methanesulfonate (MMF) -inducible Fragment Protein 1) (MaxLight 550)
127809-ML550 100 µL

HERPUD1 (HERP, KIAA0025, MIF1, Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein, Methyl Methanesulfonate (MMF) -inducible Fragment Protein 1) (MaxLight 550)

Sign In for Pricing
View Details
Prednisolone Tebutate
E6078-1g 1 g

Prednisolone Tebutate

Sign In for Pricing
View Details
4-Bromothiophenol 98%
B24940-01 5 g

4-Bromothiophenol 98%

Sign In for Pricing
View Details
4-Bromothiophenol 98%
B24940-02 25 g

4-Bromothiophenol 98%

Sign In for Pricing
View Details
4-Bromothiophenol 98%
B24940-03 100 g

4-Bromothiophenol 98%

Sign In for Pricing
View Details