Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED3 Rabbit Polyclonal Antibody (FITC)

TMED3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P26, P24B, p24g4, C15orf22, p24gamma4

UniProt

Q9Y3Q3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMED3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031390

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)
abx105271-01 20 µg

Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)

Sign In for Pricing
View Details
Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)
abx105271-02 50 µg

Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)

Sign In for Pricing
View Details
Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)
abx105271-03 100 µg

Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)

Sign In for Pricing
View Details
Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)
abx105271-04 200 µg

Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)

Sign In for Pricing
View Details
Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)
abx105271-05 1 mg

Collagen Type IV Alpha 1 (COL4A1) Antibody (Biotin)

Sign In for Pricing
View Details
JMY Knockout HEK293T Polyclonal Cells
ARG26186 1 Million

JMY Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details