Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bace1 Rabbit Polyclonal Antibody (Biotin)

Bace1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ASP2, Bace, C76936

UniProt

P56818

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035922

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100941-01 5x 96 Tests

Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100941-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100941-03 10x 96 Tests

Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100941-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Bovine Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Lentiviral human FKBP4 shRNA (UAS) - Lentiviral human FKBP4 shRNA (UAS, RFP) (100)
GTR15115752 1 Vial

Lentiviral human FKBP4 shRNA (UAS) - Lentiviral human FKBP4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GENLISA Canine Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA
KLN0848 1x 96 Well

GENLISA Canine Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA

Sign In for Pricing
View Details