Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIC2 Rabbit Polyclonal Antibody (HRP)

CHIC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTL

UniProt

Q9UKJ5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF420 Rabbit Polyclonal Antibody (FITC)
orb103755 100 µL

ZNF420 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Ezrin Rabbit mAb
orb1563852-01 20 ul

Ezrin Rabbit mAb

Sign In for Pricing
View Details
Ezrin Rabbit mAb
orb1563852-02 50 µL

Ezrin Rabbit mAb

Sign In for Pricing
View Details
Ezrin Rabbit mAb
orb1563852-03 100 µL

Ezrin Rabbit mAb

Sign In for Pricing
View Details
IL-10 Matched Antibody Pair
ASC-019P 1 Each

IL-10 Matched Antibody Pair

Sign In for Pricing
View Details
TFAM (TCF6, TCF6L2, Transcription Factor A, Mitochondrial, Mitochondrial Transcription Factor 1, Transcription Factor 6, Transcription Factor 6-like 2, TCF-6, MtTF1, mtTFA) (FITC)
MBS6396305-01 0.1 mL

TFAM (TCF6, TCF6L2, Transcription Factor A, Mitochondrial, Mitochondrial Transcription Factor 1, Transcription Factor 6, Transcription Factor 6-like 2, TCF-6, MtTF1, mtTFA) (FITC)

Sign In for Pricing
View Details