Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP8 Rabbit Polyclonal Antibody (HRP)

FKBP8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKBP38, FKBPr38

UniProt

Q14318

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036313

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRIT1 Antibody
OAAL00041-100UG 100 µg

KRIT1 Antibody

Sign In for Pricing
View Details
Goat anti-SPO11 Antibody
MBS423472-01 0.1 mg

Goat anti-SPO11 Antibody

Sign In for Pricing
View Details
Goat anti-SPO11 Antibody
MBS423472-02 5x 0.1 mg

Goat anti-SPO11 Antibody

Sign In for Pricing
View Details
Human PROC Protein Lysate 20ug
IHUPROCPLLY20UG 20 µg

Human PROC Protein Lysate 20ug

Sign In for Pricing
View Details
ERMP1 Protein Vector (Mouse) (pPM-C-HA)
PV176276 500 ng

ERMP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MAGNETIC BEAD SEPARATION PLATE, 96 Well, PCR Plate, V-Bottom, 12 Bar Halbach Array, 52MGO, NdFeB, Magnets, Gold Anodized Aluminum Magnet Frame, 1 Sided Pellet Location, Halbach Array, Beads collected to a single side of a row of wells, 1.5mm Thick Bottom Plate, designed to allow Microplate to sit flat on Cytena C.Wash platform, Non-SLAS Footprint, No Registration Base
VP 771V-2 1 EACH

MAGNETIC BEAD SEPARATION PLATE, 96 Well, PCR Plate, V-Bottom, 12 Bar Halbach Array, 52MGO, NdFeB, Magnets, Gold Anodized Aluminum Magnet Frame, 1 Sided Pellet Location, Halbach Array, Beads collected to a single side of a row of wells, 1.5mm Thick Bottom Plate, designed to allow Microplate to sit flat on Cytena C.Wash platform, Non-SLAS Footprint, No Registration Base

Sign In for Pricing
View Details