Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biotinidase (BTD), partial

Product Specifications

Product Name Alternative

(Biotinase)

Abbreviation

Recombinant Human BTD protein, partial

Gene Name

BTD

UniProt

P43251

Expression Region

322-397aa

Organism

Homo sapiens (Human)

Target Sequence

YHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSE

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.3 kDa

References & Citations

"Partial biotinidase deficiency is usually due to the D444H mutation in the biotinidase gene." Swango K.L., Demirkol M., Huener G., Pronicka E., Sykut-Cegielska J., Schulze A., Mayatepek E., Wolf B. Hum. Genet. 102:571-575 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ras-Related protein Rap-2c (RAP2C) Human ELISA Kit
G6714 96 Tests

Ras-Related protein Rap-2c (RAP2C) Human ELISA Kit

Sign In for Pricing
View Details
FSHB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
20987066 1.0 µg DNA

FSHB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PTEN Tumor Suppressor Protein Tumor Suppressor Protein (MMAC1, Phosphatase and Tensin, TEP1) (Biotin)
MBS6258423-01 0.1 mL

PTEN Tumor Suppressor Protein Tumor Suppressor Protein (MMAC1, Phosphatase and Tensin, TEP1) (Biotin)

Sign In for Pricing
View Details
PTEN Tumor Suppressor Protein Tumor Suppressor Protein (MMAC1, Phosphatase and Tensin, TEP1) (Biotin)
MBS6258423-02 5x 0.1 mL

PTEN Tumor Suppressor Protein Tumor Suppressor Protein (MMAC1, Phosphatase and Tensin, TEP1) (Biotin)

Sign In for Pricing
View Details
NUDT12 (NM_031438) Human Over-expression Lysate
LS083594-100ug 100 µg

NUDT12 (NM_031438) Human Over-expression Lysate

Sign In for Pricing
View Details
PLCB2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV741029 1.0 µg DNA

PLCB2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details