Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf103 Rabbit Polyclonal Antibody (HRP)

C20orf103 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LAMP-5, UNC-46, BADLAMP, BAD-LAMP, C20orf103

UniProt

Q9UJQ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20orf103

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf62 Polyclonal Antibody, Biotin Conjugated
A58291-100 100 µL

C10orf62 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
POU4F1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37264111 3x 1.0 µg

POU4F1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal AIFM3 Antibody [HRP]
NBP1-76378H 0.1 mL

Rabbit Polyclonal AIFM3 Antibody [HRP]

Sign In for Pricing
View Details
Mouse Monoclonal SOX5 Antibody (OTI2A8) [CoraFluor 1]
NBP2-74301CL1 0.1 mL

Mouse Monoclonal SOX5 Antibody (OTI2A8) [CoraFluor 1]

Sign In for Pricing
View Details
PIP5KIII (64-Q6)
sc-100408 100 µg/mL

PIP5KIII (64-Q6)

Sign In for Pricing
View Details
Lentiviral human GPS2 sgRNA gene knockout kit - Lentiviral human GPS2 sgRNA gene knockout kit (25)
GTR15378720 1 Vial

Lentiviral human GPS2 sgRNA gene knockout kit - Lentiviral human GPS2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details