Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN12 Rabbit Polyclonal Antibody (HRP)

TSPAN12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVR5, NET2, NET-2, TM4SF12

UniProt

O95859

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TSPAN12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036470

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1128 Antibody
E312600 100 µg - 200 µL

KIAA1128 Antibody

Sign In for Pricing
View Details
CARD8 (NM_001184900) Human Tagged Lenti ORF Clone
RC230245L4 10 µg

CARD8 (NM_001184900) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
hsa-miR-138-1-3p Primers
MPH02188 150 µL / 10 µM

hsa-miR-138-1-3p Primers

Sign In for Pricing
View Details
S100P Antibody
E300148 100 µg - 200 µL

S100P Antibody

Sign In for Pricing
View Details
Human Periostin (POSTN) ELISA Kit
MBS3800187-01 48 Well

Human Periostin (POSTN) ELISA Kit

Sign In for Pricing
View Details
Human Periostin (POSTN) ELISA Kit
MBS3800187-02 96 Well

Human Periostin (POSTN) ELISA Kit

Sign In for Pricing
View Details