Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN15 Rabbit Polyclonal Antibody (Biotin)

TSPAN15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NET7, NET-7, TM4SF15, 2700063A19Rik

UniProt

O95858

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TSPAN15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EIF3H sgRNA gene knockout kit - Lentiviral human EIF3H sgRNA gene knockout kit (25)
GTR15366813 1 Vial

Lentiviral human EIF3H sgRNA gene knockout kit - Lentiviral human EIF3H sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Olfr553 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4228302 1.0 µg DNA

Olfr553 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MMP2 Rabbit Polyclonal Antibody (PE)
orb2616235 100 µg

MMP2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Normal brain (single section per slide)
HuFPT020 5 Slides/Pack

Normal brain (single section per slide)

Sign In for Pricing
View Details
CAPN8 Protein Vector (Human) (pPM-C-HA)
PV067379 500 ng

CAPN8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CD55 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-10549R-BF405 100 µL

CD55 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details