Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN15 Rabbit Polyclonal Antibody (HRP)

TSPAN15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NET7, NET-7, TM4SF15, 2700063A19Rik

UniProt

O95858

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TSPAN15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf62 Rabbit Polyclonal Antibody
orb325951 100 µL

C19orf62 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MID1IP1 Antibody, FITC conjugated
A68377-100UG 100 µg

MID1IP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PINX1 antibody - N-terminal region
MBS3213150-01 0.1 mL

PINX1 antibody - N-terminal region

Sign In for Pricing
View Details
PINX1 antibody - N-terminal region
MBS3213150-02 5x 0.1 mL

PINX1 antibody - N-terminal region

Sign In for Pricing
View Details
Diltiazem HCl
C08103-10mM/1mL 10 mM/1mL

Diltiazem HCl

Sign In for Pricing
View Details
Tripartite Motif-Containing Protein 2 (TRIM2) Antibody (HRP)
abx305794-01 20 µg

Tripartite Motif-Containing Protein 2 (TRIM2) Antibody (HRP)

Sign In for Pricing
View Details