Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTN Rabbit Polyclonal Antibody (HRP)

NPTN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GP55, GP65, SDR1, np55, np65, SDFR1

UniProt

Q9Y639

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NPTN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_059429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B3 Mouse Monoclonal Antibody [Clone ID: LBI4A9]
AMM16497VCF 100 µg

PAFAH1B3 Mouse Monoclonal Antibody [Clone ID: LBI4A9]

Sign In for Pricing
View Details
USO1 polyclonal antibody
orb1720233-01 50 µL

USO1 polyclonal antibody

Sign In for Pricing
View Details
USO1 polyclonal antibody
orb1720233-02 100 µL

USO1 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1212066-01 0.02 mg (E-Coli)

Recombinant Escherichia coli UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1212066-02 0.02 mg (Yeast)

Recombinant Escherichia coli UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1212066-03 0.1 mg (E-Coli)

Recombinant Escherichia coli UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details