Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTN Rabbit Polyclonal Antibody (Biotin)

NPTN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GP55, GP65, SDR1, np55, np65, SDFR1

UniProt

Q9Y639

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NPTN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036560

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Klra4 shRNA (UAS) - Lentiviral mouse Klra4 shRNA (UAS) (100)
GTR15125370 1 Vial

Lentiviral mouse Klra4 shRNA (UAS) - Lentiviral mouse Klra4 shRNA (UAS) (100)

Sign In for Pricing
View Details
Phospho-Stat3 (Tyr705) (M9C6) Mouse Monoclonal Antibody
CST 4113T 20 µL

Phospho-Stat3 (Tyr705) (M9C6) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
MBS2141678-01 0.1 mL

HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
MBS2141678-02 0.2 mL

HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
MBS2141678-03 0.5 mL

HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
MBS2141678-04 1 mL

HRP-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)

Sign In for Pricing
View Details