Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG6 Rabbit Polyclonal Antibody (FITC)

ALG6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDG1C

UniProt

Q9Y672

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALG6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDEF1 (ArfGAP with SH3 Domain, Ankyrin Repeat and PH Domain 1, AMAP1, CENTB4, DDEF1, KIAA1249, PAG2, PAP, ZG14P) (MaxLight 750) discontinued
245239-ML750 100 µL

DDEF1 (ArfGAP with SH3 Domain, Ankyrin Repeat and PH Domain 1, AMAP1, CENTB4, DDEF1, KIAA1249, PAG2, PAP, ZG14P) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-Pan-Thyroid hormone receptor Antibody (N403/63)
ARO-A18109 100 µg

Anti-Pan-Thyroid hormone receptor Antibody (N403/63)

Sign In for Pricing
View Details
TPM1 Protein Vector (Mouse) (pPM-C-His)
PV240929 500 ng

TPM1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Dnajc10 shRNA (UAS) - Lentiviral mouse Dnajc10 shRNA (UAS) plasmid
GTR15169159 1 Vial

Lentiviral mouse Dnajc10 shRNA (UAS) - Lentiviral mouse Dnajc10 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human PIKFYVE Protein, N-His
orb3058411-01 50 µg

Recombinant Human PIKFYVE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PIKFYVE Protein, N-His
orb3058411-02 100 µg

Recombinant Human PIKFYVE Protein, N-His

Sign In for Pricing
View Details