Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER1L3 Rabbit Polyclonal Antibody (Biotin)

FER1L3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FER1L3

UniProt

Q9NZM1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

235kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lim-1 (Homeobox Protein Lim1, LIM Homeobox Protein 1, LHX1, LIM/Homeobox Protein Lhx1, MGC126723, MGC138141) (HRP)
MBS6485151-01 0.1 mL

Lim-1 (Homeobox Protein Lim1, LIM Homeobox Protein 1, LHX1, LIM/Homeobox Protein Lhx1, MGC126723, MGC138141) (HRP)

Sign In for Pricing
View Details
Lim-1 (Homeobox Protein Lim1, LIM Homeobox Protein 1, LHX1, LIM/Homeobox Protein Lhx1, MGC126723, MGC138141) (HRP)
MBS6485151-02 5x 0.1 mL

Lim-1 (Homeobox Protein Lim1, LIM Homeobox Protein 1, LHX1, LIM/Homeobox Protein Lhx1, MGC126723, MGC138141) (HRP)

Sign In for Pricing
View Details
PKR Antibody
orb74765 100 µL

PKR Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
MBS2116406-01 0.1 mL

HRP-Linked Polyclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
MBS2116406-02 0.2 mL

HRP-Linked Polyclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
MBS2116406-03 0.5 mL

HRP-Linked Polyclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details