Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER1L3 Rabbit Polyclonal Antibody (HRP)

FER1L3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FER1L3

UniProt

Q9NZM1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

235kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostaglandin E synthase 3 Recombinant Antibody, Cy7 Conjugated
bsm-61536R-Cy7-TR 20 µL

Prostaglandin E synthase 3 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Zincon AR For Photometric Determination of Copper & Zinc
02891 00005 5 g

Zincon AR For Photometric Determination of Copper & Zinc

Sign In for Pricing
View Details
Human TG ELISA Kit
TDEH10458 96 Tests

Human TG ELISA Kit

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit I (nuoI)
MBS1115641-01 0.02 mg (E-Coli)

Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit I (nuoI)
MBS1115641-02 0.1 mg (E-Coli)

Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit I (nuoI)
MBS1115641-03 0.02 mg (Yeast)

Recombinant Beijerinckia indica subsp. indica NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details