Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila mojavensis Eukaryotic translation initiation factor 3 subunit G-1 (eIF3-S4-1)

Product Specifications

CAS Number

9000-83-3

Gene Name

[eIF3-S4-1]

NCBI Gene ID

6585686

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[DmojGI16065; eIF3ga; dmoj_GLEANR_16804; GI16065; eIF-3 RNA-binding subunit 1]

Short Name

[Eukaryotic translation initiation factor 3 subunit G-1 (eIF3-S4-1)]

Other Product Names

[uncharacterized protein Dmoj_GI16065; Eukaryotic translation initiation factor 3 subunit G-A; GI16065 gene product from transcript GI16065-RA; Eukaryotic translation initiation factor 3 RNA-binding subunit 1]

NCBI GI Number

195133774

NCBI Accession Number

XP_002011314.1

NCBI GB Accession Number

XM_002011278.2

Uniprot Accession Number

B4L710

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO2 (LIM Domain only 2 (Rhombotin-like 1), LIM Domain only 2, T-cell Translocation Gene 2, Rhombotin 2, Rhombotin-like 1, RBTN2, RBTNL1, RHOM2, TTG2) (HRP)
207766-HRP 100 µL

LMO2 (LIM Domain only 2 (Rhombotin-like 1), LIM Domain only 2, T-cell Translocation Gene 2, Rhombotin 2, Rhombotin-like 1, RBTN2, RBTNL1, RHOM2, TTG2) (HRP)

Sign In for Pricing
View Details
hnRNP A2B1 (HNRNPA2B1) (NM_031243) Human Tagged ORF Clone Lentiviral Particle
RC224241L4V 200 µL

hnRNP A2B1 (HNRNPA2B1) (NM_031243) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-E Coli (0157, IgG2b) Antibody
MBS4159289-01 0.1 mg

Anti-E Coli (0157, IgG2b) Antibody

Sign In for Pricing
View Details
Anti-E Coli (0157, IgG2b) Antibody
MBS4159289-02 5x 0.1 mg

Anti-E Coli (0157, IgG2b) Antibody

Sign In for Pricing
View Details
Porcine alpha-kinase 1 (ALPK1) ELISA Kit
EIA07961p 1 Kit

Porcine alpha-kinase 1 (ALPK1) ELISA Kit

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details