Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adam29 Rabbit Polyclonal Antibody (Biotin)

Adam29 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q811Q4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_787953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1) (MaxLight 405) discontinued
G8235-50C-ML405 100 µL

Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 75
MBS6384365-01 0.1 mL

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 75

Sign In for Pricing
View Details
LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 75
MBS6384365-02 5x 0.1 mL

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 75

Sign In for Pricing
View Details
Bovine High mobility group protein B1 (HMGB1) ELISA Kit
OM617581 96 Strip Well

Bovine High mobility group protein B1 (HMGB1) ELISA Kit

Sign In for Pricing
View Details
Mouse E3 ubiquitin-protein ligase NEURL1B, NEURL1B ELISA Kit
MBS9323690-01 48 Well

Mouse E3 ubiquitin-protein ligase NEURL1B, NEURL1B ELISA Kit

Sign In for Pricing
View Details
Mouse E3 ubiquitin-protein ligase NEURL1B, NEURL1B ELISA Kit
MBS9323690-02 96 Well

Mouse E3 ubiquitin-protein ligase NEURL1B, NEURL1B ELISA Kit

Sign In for Pricing
View Details