Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf4 Rabbit Polyclonal Antibody (HRP)

C9orf4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CG6, CG-6, DEE37, C9orf4, EIEE37

UniProt

Q9P0K9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C9orf4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP (Alpha Fetoprotein) (C3), 1mg/mL
BNUM0354-50 1x 50 µL

AFP (Alpha Fetoprotein) (C3), 1mg/mL

Sign In for Pricing
View Details
Artocarpus integrifolia Gel -Jacalin- Immobilized Lectin
AK-6301-2 2 mL

Artocarpus integrifolia Gel -Jacalin- Immobilized Lectin

Sign In for Pricing
View Details
Osteoprotegerin (TNFRSF11B) Mouse Monoclonal Antibody [Clone ID: 5G2]
AM06539SU-N 100 µL

Osteoprotegerin (TNFRSF11B) Mouse Monoclonal Antibody [Clone ID: 5G2]

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF805521 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF568 conjugate, 0.1mg/mL
BNC682362-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Flotillin-2 Recombinant Rabbit monoclonal Antibody
HA750875 100 µL

Flotillin-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details