Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC7 Rabbit Polyclonal Antibody (HRP)

SIGLEC7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P75, QA79, AIRM1, CD328, AIRM-1, CDw328, D-siglec, SIGLEC-7, SIGLECP2, SIGLEC19P, p75/AIRM1

UniProt

Q9Y286

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIGLEC7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_055200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)
MBS7021188-01 0.02 mg

Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)
MBS7021188-02 0.1 mg

Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)
MBS7021188-03 5x 0.1 mg

Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Olr594 (NM_001000657) Rat Tagged Lenti ORF Clone
RR208162L4 10 µg

Olr594 (NM_001000657) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UT-A1 Antibody (HRP)
orb152770 100 µg

UT-A1 Antibody (HRP)

Sign In for Pricing
View Details
SNX12 Recombinant Protein (Rat)
RP230354 100 µg

SNX12 Recombinant Protein (Rat)

Sign In for Pricing
View Details