Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF21 Rabbit Polyclonal Antibody (HRP)

TNFRSF21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DR6, CD358, BM-018

UniProt

O75509

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adprh 3'UTR Luciferase Stable Cell Line
TU101460 1.0 mL

Adprh 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RASSF8, NT (RASSF8, C12orf2, Ras association domain-containing protein 8, Carcinoma-associated protein HOJ-1) (FITC)
MBS6340534-01 0.2 mL

RASSF8, NT (RASSF8, C12orf2, Ras association domain-containing protein 8, Carcinoma-associated protein HOJ-1) (FITC)

Sign In for Pricing
View Details
RASSF8, NT (RASSF8, C12orf2, Ras association domain-containing protein 8, Carcinoma-associated protein HOJ-1) (FITC)
MBS6340534-02 5x 0.2 mL

RASSF8, NT (RASSF8, C12orf2, Ras association domain-containing protein 8, Carcinoma-associated protein HOJ-1) (FITC)

Sign In for Pricing
View Details
Recombinant Mouse Resistin
BL10407_R 0.05 mg

Recombinant Mouse Resistin

Sign In for Pricing
View Details
CLDND2 Rabbit Polyclonal Antibody (AP)
orb882012 100 µL

CLDND2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mmu-miR-542-5p miRNA Mimic
orb1875922-01 5 nmol

Mmu-miR-542-5p miRNA Mimic

Sign In for Pricing
View Details