Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP10 Rabbit Polyclonal Antibody (HRP)

BMP10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95393

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BMP10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv2.1 (phospho Ser567) Antibody
A1086-01 50 μL

Kv2.1 (phospho Ser567) Antibody

Sign In for Pricing
View Details
Kv2.1 (phospho Ser567) Antibody
A1086-02 100 µL

Kv2.1 (phospho Ser567) Antibody

Sign In for Pricing
View Details
Axl (NM_031794) Rat Untagged Clone
RN200096 10 µg

Axl (NM_031794) Rat Untagged Clone

Sign In for Pricing
View Details
Rhox4b CRISPR/Cas9 KO Plasmid (m)
sc-425414 20 µg

Rhox4b CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
UBE2E3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
48968124 3x 1.0µg DNA

UBE2E3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)
MBS2117526-01 0.1 mL

APC-Cy7 Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Sign In for Pricing
View Details