Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1B Rabbit Polyclonal Antibody (HRP)

TOR1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DQ1

UniProt

O14657

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TOR1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055321

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMR4P Protein Vector (Human) (pPB-N-His)
PV075526 500 ng

EMR4P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
UGT2A1 Human Over-expression Lysate
orb1347182 100 µg

UGT2A1 Human Over-expression Lysate

Sign In for Pricing
View Details
NOA1 Protein Vector (Rat) (pPB-N-His)
PV285551 500 ng

NOA1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
AGFG2, ID (AGFG2, HRBL, RABR, Arf-GAP domain and FG repeat-containing protein 2, HIV-1 Rev-binding protein-like protein, Rev/Rex activation domain-binding protein related) (MaxLight 650) discontinued
031695-ML650 100 µL

AGFG2, ID (AGFG2, HRBL, RABR, Arf-GAP domain and FG repeat-containing protein 2, HIV-1 Rev-binding protein-like protein, Rev/Rex activation domain-binding protein related) (MaxLight 650) discontinued

Sign In for Pricing
View Details
BIBR 1532
254750-01 10 mg

BIBR 1532

Sign In for Pricing
View Details
BIBR 1532
254750-02 50 mg

BIBR 1532

Sign In for Pricing
View Details