Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WSCD2 Rabbit Polyclonal Antibody (Biotin)

WSCD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIAA0789, MGC117165

UniProt

Q2TBF2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human WSCD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055468

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YbaM Antibody
orb829499 2 mg

YbaM Antibody

Sign In for Pricing
View Details
Sheep Coagulation Factor VII ELISA Kit
MBS735947-01 48 Well

Sheep Coagulation Factor VII ELISA Kit

Sign In for Pricing
View Details
Sheep Coagulation Factor VII ELISA Kit
MBS735947-02 96 Well

Sheep Coagulation Factor VII ELISA Kit

Sign In for Pricing
View Details
Sheep Coagulation Factor VII ELISA Kit
MBS735947-03 5x 96 Well

Sheep Coagulation Factor VII ELISA Kit

Sign In for Pricing
View Details
Sheep Coagulation Factor VII ELISA Kit
MBS735947-04 10x 96 Well

Sheep Coagulation Factor VII ELISA Kit

Sign In for Pricing
View Details
Guinea pig Metallothionein-1F (MT1F) ELISA Kit
MBS7200037-01 48 Well

Guinea pig Metallothionein-1F (MT1F) ELISA Kit

Sign In for Pricing
View Details